PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_004704-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 537aa    MW: 58995.6 Da    PI: 5.7544
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_004704-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-174087148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lvd+vk++G g+W+++ ++ g+ R++k+c++rw ++l
    NNU_004704-RA 40 KGPWTSAEDAILVDYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 87
                     79******************************************9986 PP

2Myb_DNA-binding52.21.4e-1693136146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l++++++++G++ W++ a++++ gRt++++k++w++
    NNU_004704-RA  93 KGAFSQEEEKLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 136
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8723587IPR017930Myb domain
SuperFamilySSF466896.36E-3039134IPR009057Homeodomain-like
SMARTSM007174.1E-153989IPR001005SANT/Myb domain
PfamPF002493.0E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-234194IPR009057Homeodomain-like
CDDcd001671.01E-114287No hitNo description
PROSITE profilePS5129425.69788142IPR017930Myb domain
SMARTSM007177.5E-1792140IPR001005SANT/Myb domain
PfamPF002491.0E-1593136IPR001005SANT/Myb domain
CDDcd001672.58E-1295136No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2595141IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MGRSTNESEE SMVLKVQTDS PSIDEGSCGG SMNGGVVLKK GPWTSAEDAI LVDYVKKHGE  60
GNWNAVQKHS GLFRCGKSCR LRWANHLRPN LKKGAFSQEE EKLIIELHAK MGNKWARMAA  120
HLPGRTDNEI KNYWNTRIKR RQRAGLPLYP PELCLQALNE SQQSQNSGEV NSGEKRHHDL  180
LQGNSYEIPD VIFDNFKANQ GALSFPSALP DISMSSMLTQ GPGSSPNYSF MPPMMHRPKR  240
LRESEALFPS YNGSITNGFP EFEQFQGDNC QKIHRPCGMS FPYDPDPSSK NPQHFGGHSL  300
LNGNFSASKP TPGSMKLELP SLQYQETDLG GWGTSTLLPP SLESVDTFIQ SPPPTGTVQS  360
DCLSPRNSGL LEALLHEAQN LSSGKNHSFE KSSNSSVVTP SDVVDSSSLN LCDTEWEEYS  420
DPISPLGRSA ASVFRSRIKP ETIENVSTPD GEKEISNRSN LSRPDALLGT DWFEQSTENG  480
NQSVVNDAIA TLLGEDFCND YKQVPARSST LPQGQGWSLG SCAWNNMPGV CHMSELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31381415107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010251854.10.0PREDICTED: transcription factor GAMYB
RefseqXP_010251855.10.0PREDICTED: transcription factor GAMYB
RefseqXP_010251856.10.0PREDICTED: transcription factor GAMYB
SwissprotQ0JIC21e-150GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLD7UD270.0D7UD27_VITVI; Putative uncharacterized protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-136myb domain protein 65